PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.4G232200.3.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family MYB
Protein Properties Length: 543aa    MW: 59972.4 Da    PI: 4.5887
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.4G232200.3.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.83e-1965112148
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                         +g+WT+eEd++l+d+v+ +G g+W+ + r  g++R++k+c++rw ++l
  Sevir.4G232200.3.p  65 KGPWTPEEDKRLKDYVEAHGEGNWNQVQRNAGLNRCGKSCRLRWANHL 112
                         79******************************************9986 PP

2Myb_DNA-binding42.81.2e-13118161146
                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         +g++ +eE +++++ + ++G++ W++ a++++ gRt++++k++w++
  Sevir.4G232200.3.p 118 KGPFDAEEVDKIIKFHMMWGNK-WAKMASHLP-GRTDNEIKNYWNT 161
                         799*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129424.82960116IPR017930Myb domain
SuperFamilySSF466894.49E-3062159IPR009057Homeodomain-like
SMARTSM007172.6E-1664114IPR001005SANT/Myb domain
PfamPF002494.3E-1765112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.3E-2466119IPR009057Homeodomain-like
CDDcd001672.73E-1267112No hitNo description
PROSITE profilePS5129417.488117167IPR017930Myb domain
SMARTSM007175.4E-15117165IPR001005SANT/Myb domain
PfamPF002499.4E-13118161IPR001005SANT/Myb domain
CDDcd001672.70E-10120163No hitNo description
Gene3DG3DSA:1.10.10.602.1E-23120165IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MTVKVEQDPA LELPPNTEAG AGAEFSQPLS SGKEEEENDD DEDDETDSVG YDGAGNGGGA  60
PQLKKGPWTP EEDKRLKDYV EAHGEGNWNQ VQRNAGLNRC GKSCRLRWAN HLRPDLKKGP  120
FDAEEVDKII KFHMMWGNKW AKMASHLPGR TDNEIKNYWN TRLKRHQRAN LPLYPEHLCS  180
RVLDQDMNRH IPDESRGKKR SNELTQEKVV GMDDLVGDLM VFQHLDYGKD PVVPTNPLKR  240
HASTGDLSYV QSLDKVENFY SNDLNYVLTK SQSVPLGSAT ANGYPIFDGN PSTSGTIHRS  300
KKTGLPSFQC SSYEFSNSWL LQCPTASLIE QQLDTCIQSP ESMSSQNTGL LGEIVNKGDA  360
LDDCTKSERL FEMVFPPLGY NIVSQSNAYP MRHPSSSVIG DCEPEACLFD EIQASNSPSA  420
GSDAIFAYGK CYPDASFSDA RMPGTSLEAG FLNDDPLSKD QSYPYLSSSL FDADSSQEPK  480
LLTDAGQWLD SFAWKSMPGA CNMPDFPGIS SSLLGNQGYG QHILEEPKND LLQQPRLPTG  540
FN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28591651106B-MYB
1h8a_C7e-286116523126MYB TRANSFORMING PROTEIN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHF6794391e-121HF679439.1 Saccharum hybrid cultivar Co 86032 mRNA for ScMYB33 protein.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004965934.10.0PREDICTED: transcription factor GAMYB-like
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06100.14e-57myb domain protein 33